C1qTNF3/CORS26/CTRP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25766525UL

Catalog No. NB393842

Description

C1qTNF3/CORS26/CTRP3 Polyclonal specifically detects C1qTNF3/CORS26/CTRP3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: C1qTNF3/CORS26/CTRP3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: C1ATNF3, C1q and tumor necrosis factor related protein 3, cartonectin, collagenous repeat-containing sequence of 26-kDa, complement C1q tumor necrosis factor-related protein 3, complement-c1q tumor necrosis factor-related protein 3, Corcs, Cors, Cors-26, CORS26, CTRP32310005P21Rik, FLJ37576, Secretory protein CORS26
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114899
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: C1QTNF3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only