C2CD4C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP230575

Catalog No. NBP230575

Description

C2CD4C Polyclonal specifically detects C2CD4C in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: C2CD4C
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q8TF44
• Gene Symbols: C2CD4C
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PSTSEQNLASAAPRQTPRSPRLPAKLAAESKSLLKAATRHVIQIESAEDWLSEEATDADPQAQGAMSLPSVPKAQTSYGFAMLAES
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C2 Calcium-Dependent Domain Containing 4C, C2 Calcium-Dependent Domain-Containing Protein 4C, FAM148C, Family With Sequence Similarity 148, Member C, KIAA1957, NLF3, Nuclear Localized Factor 3, Nuclear-Localized Factor 3, Protein FAM148C
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 126567
• Target Species: Human
• Isotype: IgG

For Research Use Only