C2CD4C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB404907	Novus Biologicals NBP23057525UL	25ul
NBP230575	Novus Biologicals NBP230575	0.1 mL

Description

C2CD4C Polyclonal specifically detects C2CD4C in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: C2CD4C
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C2 Calcium-Dependent Domain Containing 4C, C2 Calcium-Dependent Domain-Containing Protein 4C, FAM148C, Family With Sequence Similarity 148, Member C, KIAA1957, NLF3, Nuclear Localized Factor 3, Nuclear-Localized Factor 3, Protein FAM148C
• Gene Symbols: C2CD4C
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q8TF44
• Gene ID (Entrez): 126567
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PSTSEQNLASAAPRQTPRSPRLPAKLAAESKSLLKAATRHVIQIESAEDWLSEEATDADPQAQGAMSLPSVPKAQTSYGFAMLAES
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only