Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C2GNT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169591
Description
C2GNT3 Polyclonal specifically detects C2GNT3 in Human samples. It is validated for Western Blot.Specifications
C2GNT3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
beta-1,3-galactosyl-O-glycosyl-glycoproteinbeta-1,6-N-acetylglucosaminyltransferase 4, C2GNT3, core 2 beta-1,6-N-acetylglucosaminyltransferase 3, Core 2-branching enzyme 3, Core2-GlcNAc-transferase 3, EC 2.4.1.102, glucosaminyl (N-acetyl) transferase 4, core 2, glucosaminyl (N-acetyl) transferase 4, core 2(beta-1,6-N-acetylglucosaminyltransferase) | |
Rabbit | |
36 kDa | |
100 μL | |
Primary | |
Yeast: 89%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9P109 | |
GCNT4 | |
Synthetic peptides corresponding to GCNT4(glucosaminyl (N-acetyl) transferase 4, core 2 ) The peptide sequence was selected from the C terminal of GCNT4. Peptide sequence SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF. | |
Affinity purified | |
RUO | |
51301 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction