C2orf55 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170468

Catalog No. NBP170468

Description

C2orf55 Polyclonal specifically detects C2orf55 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C2orf55
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: KIAA1211L
• Immunogen: Synthetic peptides corresponding to C2ORF55 The peptide sequence was selected from the middle region of C2ORF55. Peptide sequence ITVTRQKRRGTLDQPPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 343990
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: chromosome 2 open reading frame 55, hypothetical protein LOC343990, KIAA1211L, KIAA1211-like
• Host Species: Rabbit
• Molecular Weight of Antigen: 102 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Rat 79%, Canine 86%.
• Target Species: Human, Rat, Canine, Equine, Rabbit
• Isotype: IgG