Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C2orf55 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $487.50

Specifications

Antigen	C2orf55
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17046820 View Documents View Product Certificates	Novus Biologicals NBP17046820UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP170468 View Documents View Product Certificates	Novus Biologicals NBP170468	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

C2orf55 Polyclonal specifically detects C2orf55 in Human samples. It is validated for Western Blot.

Specifications

Antigen	C2orf55
Classification	Polyclonal
Host Species	Rabbit
Gene Alias	chromosome 2 open reading frame 55, hypothetical protein LOC343990, KIAA1211L, KIAA1211-like
Gene Symbols	KIAA1211L
Isotype	IgG
Molecular Weight of Antigen	102 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene ID (Entrez)	343990
Immunogen	Synthetic peptides corresponding to C2ORF55 The peptide sequence was selected from the middle region of C2ORF55. Peptide sequence ITVTRQKRRGTLDQPPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADF.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

C2orf55 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents