Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C2orf55 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17046820UL
Description
C2orf55 Polyclonal specifically detects C2orf55 in Human samples. It is validated for Western Blot.Specifications
C2orf55 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
chromosome 2 open reading frame 55, hypothetical protein LOC343990, KIAA1211L, KIAA1211-like | |
Rabbit | |
102 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
KIAA1211L | |
Synthetic peptides corresponding to C2ORF55 The peptide sequence was selected from the middle region of C2ORF55. Peptide sequence ITVTRQKRRGTLDQPPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADF. | |
Affinity Purified | |
RUO | |
343990 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction