C4.4A/LYPD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP232605

Catalog No. NBP232605

Description

C4.4A/LYPD3 Polyclonal specifically detects C4.4A/LYPD3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: C4.4A/LYPD3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: C4.4A2310061G07Rik, GPI-anchored metastasis-associated protein C4.4A homolog, GPI-anchored metastasis-associated protein homolog, LY6/PLAUR domain containing 3, ly6/PLAUR domain-containing protein 3, Matrigel-induced gene C4 protein, MIG-C4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27076
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: LYPD3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYP
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only