C5orf36 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156799

Catalog No. NBP156799

Description

C5orf36 Polyclonal specifically detects C5orf36 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C5orf36
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C5orf36, chromosome 5 open reading frame 36, DKFZp686F0372, FLJ27431, hypothetical protein LOC285600, KIAA0825, MGC34713
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 285600
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IV33
• Gene Symbols: KIAA0825
• Immunogen: Synthetic peptides corresponding to C5ORF36 The peptide sequence was selected from the N terminal of C5ORF36. Peptide sequence CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Crab-eating macaque: 100%; Human: 100%; Canine: 92%; Bovine: 85%;.
• Target Species: Human, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast
• Isotype: IgG