Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C5orf4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16012520UL
Description
C5orf4 Polyclonal specifically detects C5orf4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| C5orf4 | |
| Polyclonal | |
| Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| chromosome 5 open reading frame 4, FLJ13758, hypothetical protein LOC10826 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| C5ORF4 | |
| Synthetic peptides corresponding to C5ORF4 The peptide sequence was selected from the N terminal of C5ORF4. Peptide sequence MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ. | |
| 20 μL | |
| Lipid and Metabolism | |
| 10826 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction