Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C6orf223 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	C6orf223
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB402748 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP27653225UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP276532 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP276532	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

C6orf223 Polyclonal specifically detects C6orf223 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	C6orf223
Conjugate	Unconjugated
Target Species	Human
Gene Alias	chromosome 6 open reading frame 223
Gene Symbols	C6orf223
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Classification	Polyclonal
Host Species	Rabbit
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene ID (Entrez)	221416.0
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: MMPLAEAGALAQGGGPSATEWACILRRKTPRHKQPTLLMVRASRRSGKTSAVLKAGRQSVSGRKNSTSKDLVTLGASSLRE
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

C6orf223 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents