Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C9orf64 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | C9orf64 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP191505
|
Novus Biologicals
NBP191505 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
C9orf64 Polyclonal specifically detects C9orf64 in Human samples. It is validated for Western Blot.Specifications
| C9orf64 | |
| Polyclonal | |
| Rabbit | |
| NP_115683 | |
| 84267 | |
| Synthetic peptide directed towards the C terminal of human C9orf64. Peptide sequence EMLSYGDRQEVEIRGCSLWCVELIRDCLLELIEQKGEKPNGEINSILLDY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 9 open reading frame 64, hypothetical protein LOC84267, RP11-575L7.5 | |
| C9ORF64 | |
| IgG | |
| 39 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title