C9orf64 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191505

Catalog No. NBP191505

Description

C9orf64 Polyclonal specifically detects C9orf64 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C9orf64
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: chromosome 9 open reading frame 64, hypothetical protein LOC84267, RP11-575L7.5
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 79%.
• Target Species: Human, Bovine, Canine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_115683
• Gene Symbols: C9ORF64
• Immunogen: Synthetic peptide directed towards the C terminal of human C9orf64. Peptide sequence EMLSYGDRQEVEIRGCSLWCVELIRDCLLELIEQKGEKPNGEINSILLDY.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84267
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.