Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CABP4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16899520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16899520 20 μL
NBP168995 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16899520 Supplier Novus Biologicals Supplier No. NBP16899520UL

Rabbit Polyclonal Antibody

CABP4 Polyclonal specifically detects CABP4 in Human samples. It is validated for Western Blot.

Specifications

Antigen CABP4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P57796
Gene Alias CaBP4, calcium binding protein 4, CSNB2Bcalcium-binding protein 4
Gene Symbols CABP4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CABP4 (calcium binding protein 4) The peptide sequence was selected from the N terminal of CABP4. Peptide sequence PSTGEGPAGAPPASPGPASSRQSHRHRPDSLHDAAQRTYGPLLNRVFGKD.
Molecular Weight of Antigen 30 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57010
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.