CABYR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP214430

Catalog No. NBP214430

Description

CABYR Polyclonal specifically detects CABYR in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CABYR
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: CABYRa, CABYRc, calcium binding tyrosine-(Y)-phosphorylation regulated, Calcium-binding protein 86, calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2), Cancer/testis antigen 88, CBP86CABYRc/d, CT88MGC9117, fibrousheathin 2, Fibrousheathin II, fibrousheathin-2, FSP-2calcium binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2), FSP2calcium-binding tyrosine phosphorylation-regulated protein, Testis-specific calcium-binding protein CBP86
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CABYR
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: YNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSD
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 26256
• Target Species: Human
• Isotype: IgG

For Research Use Only