Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CACNA1S Antibody, Novus Biologicals™

CACNA1S Antibody, Novus Biologicals™
SDP

Catalog No. NBP233799 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP233799 0.1 mL
NB436749 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP233799 Supplier Novus Biologicals Supplier No. NBP233799
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CACNA1S Polyclonal specifically detects CACNA1S in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CACNA1S
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q13698
Gene Alias CACH1, CACN1, CACNL1A3MHS5, calcium channel, L type, alpha 1 polypeptide, isoform 3 (skeletal muscle, Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle, calcium channel, voltage-dependent, L type, alpha 1S subunit, Cav1.1, CCHL1A3, dihydropyridine receptor, dihydropyridine-sensitive L-type calcium channel alpha-1 subunit, HOKPP, HOKPP1, hypokalemic periodic paralysis), hypoPP, TTPP1, voltage-dependent L-type calcium channel subunit alpha-1S, Voltage-gated calcium channel subunit alpha Cav1.1
Gene Symbols CACNA1S
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: EEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAEL
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 779
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.