Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CACNA2D4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | CACNA2D4 |
|---|---|
| Immunogen | Synthetic peptides corresponding to CACNA2D4 (calcium channel, voltage-dependent, alpha 2/delta subunit 4) The peptide sequence was selected from the C terminal of CACNA2D4. Peptide sequence MAFLGTRAGLLRSSLFVGSEKVSDRKFLTPEDEASVFTLDRFPLWYRQ |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP16899220 |
Novus Biologicals
NBP16899220UL |
20ul |
Each for $149.00
|
|
NBP168992 |
Novus Biologicals
NBP168992 |
100 ul |
Each for $329.00
|
|
Description
CACNA2D4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| CACNA2D4 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 93589 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to CACNA2D4 (calcium channel, voltage-dependent, alpha 2/delta subunit 4) The peptide sequence was selected from the C terminal of CACNA2D4. Peptide sequence MAFLGTRAGLLRSSLFVGSEKVSDRKFLTPEDEASVFTLDRFPLWYRQ | |
| Primary | |
| IgG | |
| calcium channel, voltage-dependent, alpha 2/delta subunit 4, RCD4, voltage-dependent calcium channel subunit alpha-2/delta-4, voltage-gated calcium channel alpha(2)delta-4 subunit, Voltage-gated calcium channel subunit alpha-2/delta-4 | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title