CACNA2D4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16899220UL

Catalog No. NBP16899220

Description

CACNA2D4 Polyclonal specifically detects CACNA2D4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CACNA2D4
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q7Z3S7
• Gene Symbols: CACNA2D4
• Immunogen: Synthetic peptides corresponding to CACNA2D4 (calcium channel, voltage-dependent, alpha 2/delta subunit 4) The peptide sequence was selected from the C terminal of CACNA2D4. Peptide sequence MAFLGTRAGLLRSSLFVGSEKVSDRKFLTPEDEASVFTLDRFPLWYRQ
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha-2/delta-4.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: calcium channel, voltage-dependent, alpha 2/delta subunit 4, RCD4, voltage-dependent calcium channel subunit alpha-2/delta-4, voltage-gated calcium channel alpha(2)delta-4 subunit, Voltage-gated calcium channel subunit alpha-2/delta-4
• Host Species: Rabbit
• Molecular Weight of Antigen: 128 kDa
• Quantity: 20 μL
• Research Discipline: Vision
• Gene ID (Entrez): 93589
• Target Species: Human
• Isotype: IgG