Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CACNA2D4 Antibody, Novus Biologicals™

CACNA2D4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16899220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16899220 20 μL
NBP168992 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16899220 Supplier Novus Biologicals Supplier No. NBP16899220UL

Description

Rabbit Polyclonal Antibody

CACNA2D4 Polyclonal specifically detects CACNA2D4 in Human samples. It is validated for Western Blot.

Specifications

Antigen CACNA2D4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q7Z3S7
Gene Alias calcium channel, voltage-dependent, alpha 2/delta subunit 4, RCD4, voltage-dependent calcium channel subunit alpha-2/delta-4, voltage-gated calcium channel alpha(2)delta-4 subunit, Voltage-gated calcium channel subunit alpha-2/delta-4
Gene Symbols CACNA2D4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CACNA2D4 (calcium channel, voltage-dependent, alpha 2/delta subunit 4) The peptide sequence was selected from the C terminal of CACNA2D4. Peptide sequence MAFLGTRAGLLRSSLFVGSEKVSDRKFLTPEDEASVFTLDRFPLWYRQ
Molecular Weight of Antigen 128 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Vision
Primary or Secondary Primary
Gene ID (Entrez) 93589
Test Specificity This product is specific to Subunit or Isoform: alpha-2/delta-4.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.