Cadherin-23 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP159271	100 μL

Catalog No. NBP159271 Supplier Novus Biologicals Supplier No. NBP159271

Description

Rabbit Polyclonal Antibody

Cadherin-23 Polyclonal specifically detects Cadherin-23 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cadherin-23
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cadherin related 23, cadherin-23, cadherin-like 23, cadherin-related 23, cadherin-related family member 23, CDHR23, DKFZp434P2350, FLJ00233, FLJ36499, KIAA1774, KIAA1812, MGC102761, Otocadherin, USH1D
• Gene Symbols: CDH23
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to CDH23(cadherin-like 23) The peptide sequence was selected from the middle region of CDH23. Peptide sequence DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 64072
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Chicken: 92%; Equine: 92%; Rat: 92%; Zebrafish: 85%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only