Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Calmodulin Rabbit anti-Human, Mouse, Rat, Clone: 10W3Y7, Novus Biologicals™

Rabbit Monoclonal Antibody
Supplier: Novus Biologicals NBP31650020UL
This item is not returnable.
View return policy
Description
Calmodulin Monoclonal antibody specifically detects Calmodulin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, ImmunofluorescenceSpecifications
Calmodulin | |
Monoclonal | |
Unconjugated | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse, Rat | |
Purified |
Western Blot, Immunohistochemistry, Immunofluorescence | |
10W3Y7 | |
Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
CALM, CALM2, CALM3, CALML2, calmodulin, calmodulin 1 (phosphorylase kinase, delta), CaM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMI, CAMIII, DD132, PHKDCAM, phosphorylase kinase, delta subunit | |
A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin (P0DP23). LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK | |
20 μg | |
Cell Cycle and Replication, Neuroscience, Neurotransmission, Signal Transduction | |
801 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction