Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Calmodulin Rabbit anti-Human, Mouse, Rat, Clone: 10W3Y7, Novus Biologicals™

Rabbit Monoclonal Antibody
$205.50 - $458.50
Specifications
Antigen | Calmodulin |
---|---|
Clone | 10W3Y7 |
Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
Applications | Western Blot, Immunohistochemistry, Immunofluorescence |
Classification | Monoclonal |
Description
Calmodulin Monoclonal antibody specifically detects Calmodulin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, ImmunofluorescenceSpecifications
Calmodulin | |
Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
Monoclonal | |
Purified | |
RUO | |
Human, Mouse, Rat | |
CALM, CALM2, CALM3, CALML2, calmodulin, calmodulin 1 (phosphorylase kinase, delta), CaM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMI, CAMIII, DD132, PHKDCAM, phosphorylase kinase, delta subunit | |
A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin (P0DP23). LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK | |
Primary | |
Store at -20°C. Avoid freeze-thaw cycles. |
10W3Y7 | |
Western Blot, Immunohistochemistry, Immunofluorescence | |
Unconjugated | |
Rabbit | |
Cell Cycle and Replication, Neuroscience, Neurotransmission, Signal Transduction | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
801 | |
IgG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title