Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Calpain 1 Rabbit anti-Human, Mouse, Rat, Clone: 10E6O5, Novus Biologicals™

Calpain 1 Rabbit anti-Human, Mouse, Rat, Clone: 10E6O5, Novus Biologicals™
SDP

Catalog No. NB168466 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB168466 20 μg
NB168465 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB168466 Supplier Novus Biologicals Supplier No. NBP31668720UL
Add to Cart
Add to Cart

Description

Rabbit Monoclonal Antibody

Calpain 1 Monoclonal antibody specifically detects Calpain 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen Calpain 1
Applications Western Blot, Immunofluorescence
Classification Monoclonal
Clone 10E6O5
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias Calcium-activated neutral proteinase 1, calpain 1, (mu/I) large subunit, Calpain mu-type, calpain, large polypeptide L1, calpain-1 catalytic subunit, Calpain-1 large subunit, CANP, CANP 1, CANPL1EC 3.4.22.52, Cell proliferation-inducing gene 30 protein, cell proliferation-inducing protein 30, EC 3.4.22, Micromolar-calpain, muCANPCANP1, muCL
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Calpain 1 (P07384). DGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNG
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 823
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.