Calpain 11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233942

Catalog No. NBP233942

Description

Calpain 11 Polyclonal specifically detects Calpain 11 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Calpain 11
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q9UMQ6
• Gene Symbols: CAPN11
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WELDEVNYAEQLQEEKVSEDDMDQDFLHLFKIVAGEGKEIGVYELQRLLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGK
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Calcium-activated neutral proteinase 11, calpain 11, calpain11, calpain-11, CANP 11, EC 3.4.22, EC 3.4.22.-, EC 3.4.22.52, EC 3.4.22.54
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11131
• Target Species: Human
• Isotype: IgG

For Research Use Only