Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Calpain 2 Antibody, Novus Biologicals™

Calpain 2 Antibody, Novus Biologicals™
SDP

Catalog No. NB418243 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB418243 25 μL
NBP188204 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB418243 Supplier Novus Biologicals Supplier No. NBP18820425UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Calpain 2 Polyclonal specifically detects Calpain 2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Calpain 2
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Calcium-activated neutral proteinase 2, calpain 2, (m/II) large subunit, calpain 2, large [catalytic] subunit, calpain 2, large subunit, Calpain large polypeptide L2, Calpain M-type, calpain, large polypeptide L2, calpain-2 catalytic subunit, Calpain-2 large subunit, CANP 2, CANPL2CANP2, CANPml, EC 3.4.22, EC 3.4.22.53, FLJ39928, M-calpain, mCANP, Millimolar-calpain
Gene Symbols CAPN2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ANLEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVD
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 824
Test Specificity Specificity of human Calpain 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.