Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Calsyntenin-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15971320UL
Description
Calsyntenin-3 Polyclonal specifically detects Calsyntenin-3 in Human samples. It is validated for Western Blot.Specifications
Calsyntenin-3 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9BQT9 | |
CLSTN3 | |
Synthetic peptides corresponding to CLSTN3 (calsyntenin 3) The peptide sequence was selected from the N terminal of CLSTN3)(50ug). Peptide sequence QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA. | |
Affinity Purified | |
RUO | |
9746 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
alcadein beta, Alcadein-beta, Alc-beta, cadherin-related family member 14, calsyntenin 3, calsyntenin-3, CDHR14, CS3, CSTN3, KIAA0726alcbeta, MGC131797, MGC138488 | |
Rabbit | |
106 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction