Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CaM Kinase II delta Antibody, Novus Biologicals™
SDP

Catalog No. NBP188211 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP188211 0.1 mL
NB418238 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP188211 Supplier Novus Biologicals Supplier No. NBP188211
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CaM Kinase II delta Polyclonal specifically detects CaM Kinase II delta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CaM Kinase II delta
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias calcium/calmodulin-dependent protein kinase (CaM kinase) II delta, calcium/calmodulin-dependent protein kinase II delta, calcium/calmodulin-dependent protein kinase type II delta chain, calcium/calmodulin-dependent protein kinase type II subunit delta, CaM kinase II delta subunit, CaM kinase II subunit delta, CAMKD, CaMK-II delta subunit, CaMK-II subunit delta, CaM-kinase II delta chain, DKFZp686G23119, DKFZp686I2288, EC 2.7.11, EC 2.7.11.17, MGC44911
Gene Symbols CAMK2D
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Protein Kinase, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 817
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.