CaM Kinase II delta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB418238	Novus Biologicals NBP18821125UL	25 μL
NBP188211	Novus Biologicals NBP188211	0.1 mL

Description

CaM Kinase II delta Polyclonal specifically detects CaM Kinase II delta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CaM Kinase II delta
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: calcium/calmodulin-dependent protein kinase (CaM kinase) II delta, calcium/calmodulin-dependent protein kinase II delta, calcium/calmodulin-dependent protein kinase type II delta chain, calcium/calmodulin-dependent protein kinase type II subunit delta, CaM kinase II delta subunit, CaM kinase II subunit delta, CAMKD, CaMK-II delta subunit, CaMK-II subunit delta, CaM-kinase II delta chain, DKFZp686G23119, DKFZp686I2288, EC 2.7.11, EC 2.7.11.17, MGC44911
• Gene Symbols: CAMK2D
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Protein Kinase, Wnt Signaling Pathway
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 817
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only