CaM Kinase II gamma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257797

Catalog No. NBP257797

Description

CaM Kinase II gamma Polyclonal specifically detects CaM Kinase II gamma in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CaM Kinase II gamma
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma, calcium/calmodulin-dependent protein kinase II gamma, calcium/calmodulin-dependent protein kinase type II subunit gamma, CaM kinase II subunit gamma, CAMK, CAMKGFLJ16043, CAMK-II, CaMK-II subunit gamma, EC 2.7.11, EC 2.7.11.17, MGC26678
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CAMK2G
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSR
• Quantity: 100 μL
• Research Discipline: Protein Kinase, Signal Transduction, Tyrosine Kinases, Wnt Signaling Pathway
• Gene ID (Entrez): 818
• Target Species: Human
• Isotype: IgG

For Research Use Only