CAPSL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179507

Catalog No. NBP179507

Description

CAPSL Polyclonal specifically detects CAPSL in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: CAPSL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: calcyphosine-like, calcyphosin-like protein, MGC26610
• Host Species: Rabbit
• Molecular Weight of Antigen: 24 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 133690
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001099887
• Gene Symbols: CAPSL
• Immunogen: Synthetic peptide directed towards the C terminal of human CapslThe immunogen for this antibody is Capsl. Peptide sequence HHPKYQNGEWTEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASID.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 85% Rabbit: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG