Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CAPSL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | CAPSL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CAPSL Polyclonal specifically detects CAPSL in Rat samples. It is validated for Western Blot.Specifications
| CAPSL | |
| Polyclonal | |
| Rabbit | |
| NP_001099887 | |
| 133690 | |
| Synthetic peptide directed towards the C terminal of human CapslThe immunogen for this antibody is Capsl. Peptide sequence HHPKYQNGEWTEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASID. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| calcyphosine-like, calcyphosin-like protein, MGC26610 | |
| CAPSL | |
| IgG | |
| 24 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title