CAPZA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15641620UL

Catalog No. NBP15641620

Description

CAPZA3 Polyclonal specifically detects CAPZA3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CAPZA3
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q96KX2
• Gene Symbols: CAPZA3
• Immunogen: Synthetic peptides corresponding to CAPZA3(capping protein (actin filament) muscle Z-line, alpha 3) The peptide sequence was selected from the N terminal of CAPZA3. Peptide sequence MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha-3.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CAPAA3, CAPPA3F-actin capping protein alpha-3 subunit, capping protein (actin filament) muscle Z-line, alpha 3, CapZ alpha-3, CP-alpha-3, F-actin-capping protein subunit alpha-3, Germ cell-specific protein 3, GSG3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 93661
• Target Species: Human
• Isotype: IgG