Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Carbohydrate Sulfotransferase 2/CHST2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Carbohydrate Sulfotransferase 2/CHST2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15994420
|
Novus Biologicals
NBP15994420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159944
|
Novus Biologicals
NBP159944 |
100 μL |
Each for $487.50
|
|
|||||
Description
Carbohydrate Sulfotransferase 2/CHST2 Polyclonal specifically detects Carbohydrate Sulfotransferase 2/CHST2 in Human samples. It is validated for Western Blot.Specifications
| Carbohydrate Sulfotransferase 2/CHST2 | |
| Polyclonal | |
| Rabbit | |
| Q9Y4C5 | |
| 9435 | |
| Synthetic peptides corresponding to CHST2(carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2) The peptide sequence was selected from the middle region of CHST2. Peptide sequence NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C6ST, carbohydrate (chondroitin 6/keratan) sulfotransferase 2, carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2, carbohydrate sulfotransferase 2, EC 2.8.2.-, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2, glcNAc6ST-1, GN6ST, Gn6ST-1, GST2, GST-2, N-acetylglucosamine 6-O-sulfotransferase 1 | |
| CHST2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title