Learn More
Description
Specifications
Specifications
| Antigen | Carbonic Anhydrase X/CA10 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | carbonic anhydrase X, carbonic anhydrase-related protein 10, Carbonic anhydrase-related protein X, CARP X, CA-RPX, CARPXCA-RP X, Cerebral protein 15, cerebral protein-15, HUCEP-15 |
| Gene Symbols | CA10 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
