Learn More
Description
Specifications
Specifications
| Antigen | CARD12 |
| Applications | Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | CARD12leucine rich repeat and CARD domaincontaining 4, caspase recruitment domain family, member 12, Caspase recruitment domain-containing protein 12, Clan protein, CLAN1ipaf, CLANCARD, LRR, and NACHT-containing protein, CLR2.1, Ice protease-activating factor, Ipaf, NLR family, CARD domain containing 4 |
| Host Species | Rabbit |
| Immunogen | This antibody has been engineered to specifically recognize the recombinant protein CARD12 using the following amino acid sequence: RTLEVTLRDFSKLNKQDIRYLGKIFSSATSLRLQIKRCAGVAGSLSLVLSTCKNIYSLMVEASPLTIEDERHITSVTNLKTLSIHDLQNQRLPG |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
