Learn More
Description
Specifications
Specifications
| Antigen | CARD8 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | Apoptotic protein NDPP1, CARD inhibitor of NF-kappaB-activating ligands, CARDINALFLJ18121, CARD-inhibitor of NF-kappa-B-activating ligand, caspase recruitment domain family, member 8, caspase recruitment domain-containing protein 8, DACAR, Dakar, KIAA0955DKFZp779L0366, NDPP, NDPP1MGC57162, TUCANFLJ18119, Tumor up-regulated CARD-containing antagonist of CASP9, tumor up-regulated CARD-containing antagonist of caspase nine |
| Gene Symbols | CARD8 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PITSNTLIYYHPHPEDIKFHLYLVPSDALLTKAIDDEEDRFHGVRLQTSPPMEPLNFGSSYIVSNSANLKVMPKELKLSYRSPGEIQHFSKFYAGQMK |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
