Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CARD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | CARD8 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CARD8 Polyclonal specifically detects CARD8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
CARD8 | |
Polyclonal | |
Rabbit | |
Apoptosis | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
22900 | |
This antibody was developed against a recombinant protein corresponding to amino acids: TLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLA | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Apoptotic protein NDPP1, CARD inhibitor of NF-kappaB-activating ligands, CARDINALFLJ18121, CARD-inhibitor of NF-kappa-B-activating ligand, caspase recruitment domain family, member 8, caspase recruitment domain-containing protein 8, DACAR, Dakar, KIAA0955DKFZp779L0366, NDPP, NDPP1MGC57162, TUCANFLJ18119, Tumor up-regulated CARD-containing antagonist of CASP9, tumor up-regulated CARD-containing antagonist of caspase nine | |
CARD8 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title