CARS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157412

Catalog No. NBP157412

Description

CARS Polyclonal specifically detects CARS in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CARS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CARS1, CysRS, cysteine translase, cysteine tRNA ligase 1, cytoplasmic, Cysteine--tRNA ligase, cysteinyl-tRNA synthetase, cysteinyl-tRNA synthetase, cytoplasmic, EC 6.1.1, EC 6.1.1.16, MGC:11246
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 833
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5HYE4
• Gene Symbols: CARS
• Immunogen: Synthetic peptides corresponding to CARS(cysteinyl-tRNA synthetase) The peptide sequence was selected from the middle region of CARS. Peptide sequence QEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rat: 100%; Bovine: 92%; Chicken: 92%; Canine: 92%; Guinea pig: 92%; Mouse: 85%; Zebrafish: 84%; Pig: 78%; Rabbit: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG