CASC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25563625UL

Catalog No. NB403915

Description

CASC3 Polyclonal specifically detects CASC3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CASC3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: barentsz, Btz, cancer susceptibility candidate 3, Cancer susceptibility candidate gene 3 protein, metastatic lymph node 51, Metastatic lymph node gene 51 protein, MLN 51, MLN51BTZ, Protein barentsz, protein CASC3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CASC3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSEGEEGEYSEEENSKVELKSEANDAVNSSTKEEKGEEKPDTKSTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLR
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 22794
• Target Species: Human
• Isotype: IgG

For Research Use Only