Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CAT3/SLC7A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$499.50

Specifications

Antigen	CAT3/SLC7A3
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP174144 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP174144	100 μL	Each of 1 for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CAT3/SLC7A3 Polyclonal specifically detects CAT3/SLC7A3 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	CAT3/SLC7A3
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	P70423
Gene ID (Entrez)	84889
Immunogen	Synthetic peptides corresponding to the middle region of Slc7a3. Immunizing peptide sequence RAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEYPDFFALALVLLLTGLL.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	ATRC3cationic amino acid transporter 3, CAT3, CAT-3Cationic amino acid transporter y+, FLJ14541, MGC20687, solute carrier family 7 (cationic amino acid transporter, y+ system), member 3, Solute carrier family 7 member 3
Gene Symbols	SLC7A3
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CAT3/SLC7A3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents