Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CAT3/SLC7A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | CAT3/SLC7A3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CAT3/SLC7A3 Polyclonal specifically detects CAT3/SLC7A3 in Mouse samples. It is validated for Western Blot.Specifications
CAT3/SLC7A3 | |
Polyclonal | |
Rabbit | |
P70423 | |
84889 | |
Synthetic peptides corresponding to the middle region of Slc7a3. Immunizing peptide sequence RAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEYPDFFALALVLLLTGLL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ATRC3cationic amino acid transporter 3, CAT3, CAT-3Cationic amino acid transporter y+, FLJ14541, MGC20687, solute carrier family 7 (cationic amino acid transporter, y+ system), member 3, Solute carrier family 7 member 3 | |
SLC7A3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title