Cathepsin X/Z/P Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238703

Catalog No. NBP238703

Description

Cathepsin X/Z/P Polyclonal specifically detects Cathepsin X/Z/P in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cathepsin Z
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9UBR2
• Gene Symbols: CTSZ
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVW
• Quantity: 0.1 mL
• Research Discipline: Cancer, Epitope Tags
• Gene ID (Entrez): 1522
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Cathepsin P, Cathepsin X, cathepsin Z, CTSX, EC 3.4.18.1, FLJ17088, preprocathepsin P
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.