Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CATSPERE Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP237849
Description
CATSPERE Polyclonal specifically detects CATSPERE in Human samples. It is validated for Western Blot.Specifications
C1orf101 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
C1orf101 | |
The immunogen for Anti-CA101 antibody is: synthetic peptide directed towards the N-terminal region of Human CA101.. Peptide sequence: CFLWYYRVRHFFNNFTQLITVWAYDPESADPDELLGNAEEPSINSIVLST | |
Affinity purified | |
RUO | |
257044 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q5SY80.2 | |
Rabbit | |
91 kDa | |
100 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction