CBFB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP187300

Catalog No. NBP187300

Description

CBFB Polyclonal specifically detects CBFB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CBFB
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CBF-beta, core-binding factor subunit beta, core-binding factor, beta subunit, PEA2-beta, PEBP2B, PEBP2-beta, polyomavirus enhancer binding protein 2, beta subunit, Polyomavirus enhancer-binding protein 2 beta subunit, SL3/AKV core-binding factor beta subunit, SL3-3 enhancer factor 1 beta subunit, SL3-3 enhancer factor 1 subunit beta
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CBFB
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKV
• Quantity: 0.1 mL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 865
• Target Species: Human
• Isotype: IgG

For Research Use Only