Cbl-c Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255259

Catalog No. NBP255259

Description

Cbl-c Polyclonal specifically detects Cbl-c in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Cbl-c
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Cas-Br-M (murine) ecotropic retroviral transforming sequence c, Cas-Br-M (murine) ectropic retroviral transforming sequence c, CBL3, CBL-3, CBL-SL, RING finger protein 57, RNF57SH3-binding protein CBL-3, SH3-binding protein CBL-C, signal transduction protein CBL-C
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CBLC
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGPGGPGGSGDFLLIYL
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 23624
• Target Species: Human
• Isotype: IgG

For Research Use Only