Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CBLL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18358925UL
Description
CBLL1 Polyclonal specifically detects CBLL1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CBLL1 | |
Polyclonal | |
Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500 | |
Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1, Casitas B-lineage lymphoma-transforming sequence-like protein 1, c-Cbl-like protein 1, E3 ubiquitin-protein ligase Hakai, EC 6.3.2, EC 6.3.2.-, E-cadherin binding protein E7, HAKAIRNF188FLJ23109, MGC163401, MGC163403, RING finger protein 188 | |
Rabbit | |
Affinity Purified | |
RUO | |
79872 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CBLL1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Product Content Correction