Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP152906

CBP/KAT3A Antibody, Novus Biologicals™
SDP

Catalog No. NBP152906 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP152906 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP152906 Supplier Novus Biologicals Supplier No. NBP152906
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CBP/KAT3A Polyclonal specifically detects CBP/KAT3A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CBP/KAT3A
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 5 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q92793
Gene Alias CBPRTS, CREB binding protein, CREB-binding protein, EC 2.3.1.48, KAT3A, RSTS, Rubinstein-Taybi syndrome
Gene Symbols CREBBP
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CREBBP(CREB binding protein (Rubinstein-Taybi syndrome)) The peptide sequence was selected from the N terminal of CREBBP (NP_001073315). Peptide sequence TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS.
Molecular Weight of Antigen 261 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer, Cellular Markers, Chromatin Research, HIF Target Genes, Hypoxia, Membrane Trafficking and Chaperones, Signal Transduction, Stem Cell Signaling Pathway, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 1387
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%.
Reconstitution Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.