CBR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152872

Catalog No. NBP152872

Description

CBR1 Polyclonal specifically detects CBR1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CBR1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 15-hydroxyprostaglandin dehydrogenase [NADP+], carbonyl reductase (NADPH) 1, carbonyl reductase (NADPH) 1, EC 1.1.1.18410EC 1.1.1.197,15-hydroxyprostaglandin dehydrogenase, carbonyl reductase [NADPH] 1, carbonyl reductase 1, CBR, CRN, EC 1.1.1.184, EC 1.1.1.189, hCBR1, NADPH-dependent carbonyl reductase 1, Prostaglandin 9-ketoreductase, Prostaglandin-E(2) 9-reductase, SDR21C1, short chain dehydrogenase/reductase family 21C, member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 873
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P16152
• Gene Symbols: CBR1
• Immunogen: Synthetic peptides corresponding to CBR1(carbonyl reductase 1) The peptide sequence was selected from the C terminal of CBR1 (NP_001748). Peptide sequence PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Equine: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

For Research Use Only