CC Chemokine Receptor D6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188150

Catalog No. NBP188150

Description

CC Chemokine Receptor D6 Polyclonal specifically detects CC Chemokine Receptor D6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CC Chemokine Receptor D6
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: C-C chemokine receptor D6, CCR10CCR9D6CC-chemokine-binding receptor JAB61, chemokine (C-C) receptor 9, chemokine binding protein 2, Chemokine receptor CCR-10, Chemokine receptor CCR-9, chemokine receptor D6, chemokine-binding protein 2, Chemokine-binding protein D6, CMKBR9chemokine (C-C motif) receptor 9, hD6, MGC126678, MGC138250
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ACKR2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA
• Quantity: 0.1 mL
• Research Discipline: Cytokine Research, GPCR, Immunology, Innate Immunity, Signal Transduction
• Gene ID (Entrez): 1238
• Target Species: Human
• Isotype: IgG

For Research Use Only