CC Chemokine Receptor D6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB418279	Novus Biologicals NBP18815025UL	25 μL
NBP188150	Novus Biologicals NBP188150	0.1 mL

Description

CC Chemokine Receptor D6 Polyclonal specifically detects CC Chemokine Receptor D6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CC Chemokine Receptor D6
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: C-C chemokine receptor D6, CCR10CCR9D6CC-chemokine-binding receptor JAB61, chemokine (C-C) receptor 9, chemokine binding protein 2, Chemokine receptor CCR-10, Chemokine receptor CCR-9, chemokine receptor D6, chemokine-binding protein 2, Chemokine-binding protein D6, CMKBR9chemokine (C-C motif) receptor 9, hD6, MGC126678, MGC138250
• Gene Symbols: ACKR2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cytokine Research, GPCR, Immunology, Innate Immunity, Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 1238
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only