CCAR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255611

Catalog No. NBP255611

Description

CCAR1 Polyclonal specifically detects CCAR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CCAR1
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: CARP-1, CARP1MGC44628, Cell cycle and apoptosis regulatory protein 1, cell division cycle and apoptosis regulator 1, cell division cycle and apoptosis regulator protein 1, Death inducer with SAP domain, DIS, FLJ10590, RP11-437A18.1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CCAR1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KEERDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEEMTKRDDKRDINRYCKERPSKDKEKEKTQMITINRDLLMAFVYFDQSHCGYLLE
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cell Cycle and Replication, DNA Repair
• Gene ID (Entrez): 55749
• Target Species: Human
• Isotype: IgG

For Research Use Only