Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCAR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	CCAR1
Dilution	Immunohistochemistry-Paraffin 1:50 - 1:200
Applications	Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP255611 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP255611	100 μL	Each for $610.00	Only null left	Sign In or Register to check your price. Add to Cart

NB394917 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25561125UL	25 μL	Each for $382.00	Only null left	Sign In or Register to check your price. Add to Cart

Description

CCAR1 Polyclonal specifically detects CCAR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	CCAR1
Applications	Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Alias	CARP-1, CARP1MGC44628, Cell cycle and apoptosis regulatory protein 1, cell division cycle and apoptosis regulator 1, cell division cycle and apoptosis regulator protein 1, Death inducer with SAP domain, DIS, FLJ10590, RP11-437A18.1
Gene Symbols	CCAR1
Isotype	IgG
Purification Method	Affinity Purified

Dilution	Immunohistochemistry-Paraffin 1:50 - 1:200
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Apoptosis, Cell Cycle and Replication, DNA Repair
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	55749
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KEERDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEEMTKRDDKRDINRYCKERPSKDKEKEKTQMITINRDLLMAFVYFDQSHCGYLLE
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CCAR1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents